SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TDS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TDS8
Domain Number 1 Region: 362-423
Classification Level Classification E-value
Superfamily BPTI-like 7.8e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.005
Further Details:      
 
Domain Number 2 Region: 236-299
Classification Level Classification E-value
Superfamily BPTI-like 1.99e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0042
Further Details:      
 
Domain Number 3 Region: 312-349
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  G3TDS8
Domain Number - Region: 206-239
Classification Level Classification E-value
Superfamily PKD domain 0.00549
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TDS8
Sequence length 491
Comment (tr|G3TDS8|G3TDS8_LOXAF) Serine peptidase inhibitor, Kunitz type 1 {ECO:0000313|Ensembl:ENSLAFP00000012355} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SPINT1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MAGARLAQARISAAAAAAVWLLWALGLPGTEAGPPPLPLRPPAGTACLDLFTAGVPAFVL
DTEASVSNGATFLGSPAVRRDWDCVRACCATHSCNLALVELRPNGLEDDTPSCFLMNCLY
EQNFVCKFAPREGFINYLMREVYSSYRELQTQGFGESRVPKAWAGMDLKVQPQEPLGLRS
DENTEWHLLQGDTAVRVEKNDPDQVKLWGLQEGTYLFQLTVTNSDQPDNTANLTVTVLSA
KQTEYCLASYKVGRCRGAFPRWYYSPPEQVCKSFIYGGCLGNKNNYLREEECKLACRDVQ
GPSMERQHPVCSGTCQATQFRCGDGCCIDGFLECDDTPDCPDASDEATCEKYTSGFDELQ
SFHFPSDKGHCVDLPDTGLCQESIPRWYYNPFTEHCSRFTYGGCHGNKNNFEEEQHCLES
CRGISKKDVFGLRRENPTPSVGSVEVAIAVLLAACIVVVIAILGYCFFKNQRKGLREDTE
HLVYNHTTRPL
Download sequence
Identical sequences G3TDS8
ENSLAFP00000012355 ENSLAFP00000012355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]