SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TE54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TE54
Domain Number 1 Region: 195-335
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 85-194
Classification Level Classification E-value
Superfamily Second domain of FERM 9.94e-40
Family Second domain of FERM 0.000000579
Further Details:      
 
Domain Number 3 Region: 492-579
Classification Level Classification E-value
Superfamily Moesin tail domain 4.32e-33
Family Moesin tail domain 0.0000222
Further Details:      
 
Domain Number 4 Region: 2-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-25
Family First domain of FERM 0.00000856
Further Details:      
 
Weak hits

Sequence:  G3TE54
Domain Number - Region: 429-473
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.00445
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TE54
Sequence length 600
Comment (tr|G3TE54|G3TE54_LOXAF) Radixin {ECO:0000313|Ensembl:ENSLAFP00000012502} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=RDX OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
INVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKK
VTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVL
LASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLR
EDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSE
IRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQ
MKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTMKAQKE
LEEQTRRALELDQERKRAKEAAERLEKERQAAEEAKAAIEKQAADQMKNQEQLAAELAEF
TAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSTPPPPPPPPVIPPTEN
EHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDETKK
TQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAMWGPKLYALFQIRSCQSSIKQM
Download sequence
Identical sequences G3TE54
ENSLAFP00000012502 ENSLAFP00000012502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]