SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TED5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TED5
Domain Number 1 Region: 11-130,321-645
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.06e-76
Family Integrin alpha N-terminal domain 0.0000719
Further Details:      
 
Domain Number 2 Region: 149-342
Classification Level Classification E-value
Superfamily vWA-like 7.79e-52
Family Integrin A (or I) domain 0.0000000197
Further Details:      
 
Domain Number 3 Region: 648-791
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-34
Family Integrin domains 0.00066
Further Details:      
 
Domain Number 4 Region: 794-919
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-21
Family Integrin domains 0.011
Further Details:      
 
Domain Number 5 Region: 926-1127
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-20
Family Integrin domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TED5
Sequence length 1161
Comment (tr|G3TED5|G3TED5_LOXAF) Integrin subunit alpha 1 {ECO:0000313|Ensembl:ENSLAFP00000012598} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ITGA1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
LKALLGFCISFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGKWVLIGSPLAGQPKNRTGD
VYKCPVGRNKSSPCIKLDLPVNTSIPNVTEAKENMTFGSTLVTNPNGGFLACGPLYAYRC
GHLHYTTGICSDVSPTFQVVNSIAPIRECSTQLDIVIVLDGSNSIYPWESVTDFLNDLLE
KMDIGPKQTQVGIVQYGENVTHEFNLNKYSTTEEVRVAASKIVQRGGRQTMTALGIDTAR
KEAFTEARGARRGVKKVMVIVTDGESHDNHQLNKVIQDCEDENIQRFSIAILGSYNRGNL
STEKFVEEIRSIASEPTEKHFFNVSDELALVTIVEALGERIFALEATADQSAASFEMEMS
QTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKADQIIVPPNTTFNVESTKKKEPLASYLGY
TVNSATVSGDVLYIAGQPRYNHTGQVIVYRMENRDIQILQTLHGEQIGSYFGSVLTTIDI
DKDSNTDILLVGAPTYMGTEKEEQGKVYVYALNQTRFEYQMSLEPIKQTCCSSLKHDSCT
KENRNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHAGAVYIYHGSGKTIKEEYTQ
RIPSGGDGKTLKFFGQSVHGEMDLNGDGLTDVTIGGLGGAALFWSRDVAVVKVTMNFEPN
KVNIENKNCQVEGKETVCINATVCFDVKLKSKEDVMYEADLQYRVTLDSLRQISRSFFSG
TQERKIQRNITVRGSECTKHFFYMLDKHDFRDSVRITLDFNLTDPENGPVLDDSVPNSVH
EYIPFAKDCGNKEKCISDLGLDVSTIEKGLLIVKSHNDKFNVSLTVKNKKDSAYNTRTIT
NYSPNLIFSGIEAIQKDSCESNHNITCKVGYPFLRRGEEVTFKIVFQFNASYLMENVIIH
LTATSDSEEPPEALSDNEVNISIPVKYEVGLQFYSSASEYHISIAANETVPESINSTEDI
GNEINIFYLIRKSGHFPMPELKLSISFPNLTSDGYPVLYPTGWSSSDNANCRPNSLQDPL
GINSGKKTIIFKSEDLKRGTILDCSTCKFAAITCNLMPSDVSQVNVSLTLWKPTFIKARF
SSLNLTVRAELQSENTSLVLNSGNKKRELAIQVSKDGLPGRVPLWVILLSAFAGLLLLML
LILALWKIGFFKRPLKKKMEK
Download sequence
Identical sequences G3TED5
ENSLAFP00000012598 ENSLAFP00000012598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]