SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TFC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TFC0
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-43
Family Galectin (animal S-lectin) 0.00000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TFC0
Sequence length 130
Comment (tr|G3TFC0|G3TFC0_LOXAF) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LGALS2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
AQEEFEIKNMDMKLGATLKIKGKIANDAVGFVINLGQGAEKLNLHFNPRFNESTIVCNSR
DGSWGQEQRSNHLCFSPGSEVKFTVTFENKQFKVTLPDGHVLTFPNRLGHSHLSYLGVKG
GFKISSFKLD
Download sequence
Identical sequences G3TFC0
ENSLAFP00000013013 ENSLAFP00000013013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]