SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TFL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TFL4
Domain Number 1 Region: 632-742
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 449-571
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-21
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 3 Region: 749-814
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000148
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 285-392
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000471
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 5 Region: 808-870
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000709
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 876-935
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000121
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 396-457
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000486
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 571-635
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000117
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TFL4
Sequence length 1028
Comment (tr|G3TFL4|G3TFL4_LOXAF) Seizure related 6 homolog like {ECO:0000313|Ensembl:ENSLAFP00000013129} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SEZ6L OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MPAARPPTAGLSGISLLLALLLGSPVAALVGDAHPEGDAGPSGTYPLPWRALESSSLNKD
SPEERVTRAPPNPAQSGDQLLELELAGMAPPTSPDTQALSTLLPEQVGTKHTLIPRRKPP
SLKQVNTARKQLRPKATPTAALQSPGSQPTTLGQELFSSTEKSRPPGDLDLFTSAEMHQP
SSEVPLWLDQKEGTVPTTPAPLQISPFTSQPYVAHTLPQKPDPGEPLGPEESHEASLEEA
SPMTLMDKGGESELTGSASEENQETTTSTIITTTVITTEQAPALCSVSFSDPEGYIDSSD
YPPLPLNNFLECMYNVTVYTGYGVELQVKSVNLSEGELLSIRGVDGPTLTVLANQTLLVE
GQVIRSPTNTISIYFRTFQEDGLSTFQLHYQAFMLSCSFPHRPDFGDVTVMDLHSGGVAH
FHCHLGYELQGAKTLTCINASKPHWSSPEPICSAPCGGAVHNATIGRVLSPSYPGSTNGS
QVCVWTIEAPEGQKLHLHFERLSLNEKDRMMVYSGRTNKSALLYDSFQTESVPFEGLLSD
SNTISIEFMSDQARVASAFNIRFEAFEKGHCYEPYIQNGNFTTSDATYNIGTIVEFTCDP
GHSLEQGPAVIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVEGEDCVW
KIHVGEEKRIFLDIQLLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDLTIQ
FHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQCDPG
YDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNP
GFVLEGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGES
LTFMCYEGFELMGEVTIRCILGQPSHWNGPLPVCKVNQDSFEHALEVAEAAAETSLEGGN
MALAIFIPVLIISLVLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGE
TREYEVSI
Download sequence
Identical sequences G3TFL4
ENSLAFP00000013129 ENSLAFP00000018719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]