SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TFM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TFM3
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000654
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TFM3
Sequence length 264
Comment (tr|G3TFM3|G3TFM3_LOXAF) Somatomedin B and thrombospondin type 1 domain containing {ECO:0000313|Ensembl:ENSLAFP00000013140} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SBSPON OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MRTLWLALCALARLWPGALAGCAEAGRCCPGRDPACFTHGWRLDRVYGTCFCDQACILTG
DCCFDYSRACPARPCIVGEWSPWSGCADQCKPTARIRRRPVRQEPQNGGAPCPPLEERAG
CLEYSTPQGQDCGHAFVPAFITTSAFNKERTRQAASPQWSTDTQDPGYCMEFKTESLTHH
CAMENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDTDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences G3TFM3
ENSLAFP00000013140 ENSLAFP00000013140 XP_010586649.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]