SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TFN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TFN5
Domain Number 1 Region: 150-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-86
Family Protein kinases, catalytic subunit 0.00000000000298
Further Details:      
 
Domain Number 2 Region: 1-147
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.03e-38
Family Regulator of G-protein signaling, RGS 0.0000000805
Further Details:      
 
Domain Number 3 Region: 517-556
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000002
Family Pleckstrin-homology domain (PH domain) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TFN5
Sequence length 560
Comment (tr|G3TFN5|G3TFN5_LOXAF) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=GRK2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
SIRSVMQKYLEDRGEVAFEKIFSQKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLET
EEERLARSREIFDVYIMKELLACSHPFSKSATEHVQGHLVKKQVPPDLFQPYIEEICQNL
RGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMY
AMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGG
DLHYHLSQHGVFSEADMRFYAAEIILGLEHMHNCFVVYRDLKPANILLDEHGHVRISDLG
LACDFSKKKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTK
DKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLD
WQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERW
QQEVAETVFDTINVETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQ
RRYFYLFPNRLEWRGEGEAP
Download sequence
Identical sequences G3TFN5
ENSLAFP00000013154 ENSLAFP00000013154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]