SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TFR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TFR5
Domain Number 1 Region: 533-596,863-982
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0062
Further Details:      
 
Domain Number 2 Region: 4-194
Classification Level Classification E-value
Superfamily RUN domain-like 1.07e-35
Family RUN domain 0.00054
Further Details:      
 
Domain Number 3 Region: 959-1081
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TFR5
Sequence length 1089
Comment (tr|G3TFR5|G3TFR5_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000013197} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SGSM1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
TEADTRQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFL
RSNKIAALFMKVGKSFPPAEELSRKVQDLEQLIESARNQIQGLQENVRKLPKLPSLSPLA
IKHLWIRTALFEKVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKM
KTADHFWTDPSADELVQRHRIHGSHLRQDSPTKRPALCIQKRHSSGSMDDRPSLSARDYV
ESLHQNSRTTLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLD
YEKSVYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPRGGHLLQFLSC
LENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSAESTSSDKEDDEATDYVFRIIYPG
MQSEFGPQDLMDVSVSNLPSLWQPSPRKSSCSSCSQSGSADGGSTNGCNHERAPLKLLCD
NMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHRIVYPDLPCDAGHGLTAGIWEQYLQD
STSYEEQELLRLIYYGGIQPEIRKAVWPFLLGHYQFGMSAAERKEVDEQVHACYAQTMAE
WLGCEAIVRQRERESHAAALAKCSSGASLDSHLHRMMHRDSTISNESSQSCSSGRQNIRL
QSDSSSSTQVFESVDEVEQVEAEGRLEEKHPKIPNGNLVNGTCSPDSGHPSSHNFSSGLS
EHSEPSLSTEDSVMDAQRNVPPVLQPGDSSVDDGQSSEATTSRDEAPREELAVQDSLESD
LLANESMDEFMSITGSMDVALPDKEGMGMDGWEGSEAEKRSQADSEDNLSEEPEMESLFP
ALASLAVTTSANSEASPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRNYWYFTPANLE
KLRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDDEALAFSCFTELMKRMNQNFPHGGAM
DTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELIYDDVFSVWETIWA
AKHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNSKQVLKLARDLVY
KVQTLIENK
Download sequence
Identical sequences G3TFR5
ENSLAFP00000013197 ENSLAFP00000013197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]