SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TG58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TG58
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.53e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 2 Region: 219-365
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-24
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 129-228
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-17
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TG58
Sequence length 374
Comment (tr|G3TG58|G3TG58_LOXAF) ArfGAP with dual PH domains 1 {ECO:0000313|Ensembl:ENSLAFP00000013435} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ADAP1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MAKERRRPVLELLQRPGNERCADCGAPDPDWASHTLGVFICLSCSGIHRNIPQVSKVKSV
RLDAWDEAQVEFMASHGNDAARATYEARVPSFYYRPSFSDCQLLREQWIRAKYERKEFVH
PEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNKNDAKEPKAIMKIEHL
NATFQPVKIGHPHGLQVTYLKDNSTRNIFVYHEDGKEIVDWFNALRAARFHYLQVAFPGA
SDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIG
SKEGGYSVLEGLPPSTQGHHWAHGVTIVTPDRKFLFACETEADRREWVAAFRSVVDRPML
PQEYAVEAHFKHKP
Download sequence
Identical sequences G3TG58
ENSLAFP00000013435 ENSLAFP00000013435 XP_003416676.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]