SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3THA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3THA8
Domain Number 1 Region: 201-410
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-59
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 393-555
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-35
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 
Domain Number 3 Region: 577-738
Classification Level Classification E-value
Superfamily PH domain-like 3.81e-22
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3THA8
Sequence length 766
Comment (tr|G3THA8|G3THA8_LOXAF) FYVE, RhoGEF and PH domain containing 4 {ECO:0000313|Ensembl:ENSLAFP00000013929} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=FGD4 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MEEVKPAPASCVSKEKSSKVSDLISRFEGGSTLSNYSDLKKEPAVSLNAPRTLGMHGLTT
TPQQKLLSQHPLQKQRNDTDQTQGVQTCVANGVMAAQNQMECEEDKAAPLSPDTSLQTPV
PLLDTNLVNGERDETATGPASPTTDICDGNASDSDCRTPDTGPVLTLEKGTVETDAKVQE
RENGECPLELEQLDQHHELKETNEQKLHKIANELLLTERAYVNRLDLLDQVFYCKLLEEA
NRGSFPAEMVNKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKLAPFLKMYG
EYVKGYDNAMELVKNMTERIPQFKSVVEEIQKQKICGSLTLQHHMLEPVQRIPRYELLLK
DYLRKLPPDSLDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEGEDIVNPS
NELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTKVGLDGMTIVE
THNEEYPHTFQVSGKERTLELQASSEQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDI
HSEVSTAELGKRAPRWIRDNEVTMCMKCKEPFNALTRRRHHCRACGHVVCWKCSDYKAQL
EYDGGKLSKVCKDCYQIISGFTESEEKKRKGILEIESAEVSGNSVVCSFLQYMEKSKPWQ
KTWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPRSADLPHSFRLTQSKSVHSF
AADSEELKQKWLKIILLAVRGETPDGPNEHPATWDDHAEPKSKSEC
Download sequence
Identical sequences G3THA8
ENSLAFP00000013929 ENSLAFP00000013929 XP_010594048.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]