SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3THC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3THC7
Domain Number 1 Region: 162-263
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.09e-21
Family Synaptotagmin-like (S variant) 0.0058
Further Details:      
 
Domain Number 2 Region: 303-506
Classification Level Classification E-value
Superfamily vWA-like 6.67e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 3 Region: 25-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.33e-21
Family Synaptotagmin-like (S variant) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3THC7
Sequence length 558
Comment (tr|G3THC7|G3THC7_LOXAF) Copine 7 {ECO:0000313|Ensembl:ENSLAFP00000013953} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=CPNE7 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
PASMSARSESEAATAAVPAPCASKVELRLSCRHLLDRDPLTKSDPSVVLLLQSQGQWVQV
DRTEVVRSSLHPVFSKVFTLDYYFEEVQKLRFEVYDTHGPGGLSCPEDDFLGGTECTLGQ
IVAQKKMTRALLLKSGRNAGKSTITVIAEDISGNDGYVELSFRAKKLDDKDLFSKSDPFL
ELYRVNDDQSEQLVYRTEVVKNNLSPVWEPFKVSLNSLCSCEETRPLKCLVWDYDSRGKH
DFIGEFSTTFQEMQKASGRQAQWDCVNAKYKQKRRNYKNSGVVILSHLKVHRVYSFLDYI
MGGCQIHFTVAIDFTASNGDPRNSCSLHYINPYQPNEYLRALVAVGEICQDYDSDKRFSA
LGFGARIPPKYEVSHDFAINFNPDNDECEGIQGVVESYQNCLPKVQLYGPTNVAPIISKV
ARTAAAEERTGEASQYYILLILTDGVVTDMADTREAIVRASHLPMSIIIVGVGNADFTDM
QILDGDDGVLRSPRGEPALRDIVQFVPFRELKNASPSALAKCVLAEVPKQVVEYYSHKEL
PPRGLNTHSQEGGPVLAL
Download sequence
Identical sequences G3THC7
ENSLAFP00000013953 ENSLAFP00000013953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]