SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3THH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3THH1
Domain Number 1 Region: 20-257
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-48
Family Nuclear receptor ligand-binding domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3THH1
Sequence length 260
Comment (tr|G3THH1|G3THH1_LOXAF) Nuclear receptor subfamily 0 group B member 2 {ECO:0000313|Ensembl:ENSLAFP00000014013} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NR0B2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MSSSQPAACPCQGAAGRPAILHALLSPSLRARPFVPPTHSRCLCQQHKPVRLCTPHRTCQ
EALDVLGKTVAFLKNLPSFCQLPPQDQRRLLRDCWGPLFLLGLAQDTVTFEVAEVPVASI
LKKILLEEPGSSGSSSQLPDRPQPSLAAVQWLQCCLESFWSLELGPKEYAYLKKTILFNP
DVPGLLAPSHIGYLQQEAHQALCEVLEAWWPIGQGRLARILLMASTLKSIPPGLLGDLFF
RPVIGDVDMAGLLEDMLLLS
Download sequence
Identical sequences G3THH1
XP_003415309.1.64505 ENSLAFP00000014013 ENSLAFP00000014013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]