SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TI23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TI23
Domain Number 1 Region: 124-289
Classification Level Classification E-value
Superfamily RUN domain-like 9.68e-54
Family RUN domain 0.000000026
Further Details:      
 
Domain Number 2 Region: 577-670
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000384
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.012
Further Details:      
 
Weak hits

Sequence:  G3TI23
Domain Number - Region: 329-376
Classification Level Classification E-value
Superfamily Prefoldin 0.00196
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TI23
Sequence length 678
Comment (tr|G3TI23|G3TI23_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000014270} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=RUFY3 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MAETPSPPSAGAESYSEEPVRGGERRPEEPRSAPAGGADRESEAGPPLASPAAQSEPDSP
VAAPFFLLYPGNGGAGFPARLPPQQQRVWRTPPSPGSPLPFLLLSYPSGGGGGGGKHNPN
YLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTF
LGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKA
LINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSMYL
KDGNSSKGSEGDGQITAILDQKNYVEELNRHLNATVNNLQAKVDALEKSNTKLTEELAVA
NNRIITLQEEMERVKEESSYILESNRKGPKQDRTSEGQALSEARKHLKEETQLRLDVEKE
LEIQIGMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQK
SELNSRLEEKTNQMAATIKQLEQRLRQAERGRQSAELDNRLFKQDFGDKINSLQLEVEEL
TRQRNQLELELKQERERRLQNNSNVPGKGSQKTEPKTDGKHRIQEENVNLKKPLEESHRL
QSHPMDQQDQPLLSEKPQVCQLCQEDDGSIKKNVCKNCKGTFCNACSTNELPLPSSITPE
RVCNSCHKHLMKQYSTSP
Download sequence
Identical sequences G3TI23
ENSLAFP00000014270 ENSLAFP00000014270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]