SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TI29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TI29
Domain Number 1 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 2 Region: 110-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 70-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TI29
Sequence length 345
Comment (tr|G3TI29|G3TI29_LOXAF) Low density lipoprotein receptor class A domain containing 3 {ECO:0000313|Ensembl:ENSLAFP00000014277} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LDLRAD3 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MWLLGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGSWQCDGLPDCFDKSD
EKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARFHC
KNGLCIDKSFICDGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSS
VIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQ
YVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSA
NSASSQAPSSLLSMEDTGHSLGQPGPPEGTVEPRDSLPSQGIEEV
Download sequence
Identical sequences G3TI29
ENSLAFP00000014277 XP_010590426.1.64505 ENSLAFP00000014277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]