SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TI35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TI35
Domain Number 1 Region: 1063-1157
Classification Level Classification E-value
Superfamily C-type lectin-like 1.26e-31
Family Link domain 0.00015
Further Details:      
 
Domain Number 2 Region: 439-592
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-29
Family FAS1 domain 0.0011
Further Details:      
 
Domain Number 3 Region: 605-747
Classification Level Classification E-value
Superfamily FAS1 domain 1.24e-24
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 4 Region: 3-130
Classification Level Classification E-value
Superfamily FAS1 domain 5.76e-22
Family FAS1 domain 0.0066
Further Details:      
 
Domain Number 5 Region: 1153-1313
Classification Level Classification E-value
Superfamily FAS1 domain 6.8e-21
Family FAS1 domain 0.0094
Further Details:      
 
Domain Number 6 Region: 339-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.063
Further Details:      
 
Domain Number 7 Region: 381-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000018
Family EGF-like domain of nidogen-1 0.068
Further Details:      
 
Domain Number 8 Region: 951-987
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000026
Family Merozoite surface protein 1 (MSP-1) 0.089
Further Details:      
 
Weak hits

Sequence:  G3TI35
Domain Number - Region: 250-378
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000204
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number - Region: 997-1030
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 865-992
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00148
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 826-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 210-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0766
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TI35
Sequence length 1397
Comment (tr|G3TI35|G3TI35_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000014285} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
SLPSLLTRLDQMPGYSIFRGYIIQYNLASVIEAADAYTVFAPNNKAIENYIREKKAATLE
EDIVRYHVVLEEKLLKNDLHNGMHRETMLGFSYFLGFFLRNDQVYVNDAHINYTNAATDK
GVIHGLEKVLEIQKNRCDNNNTTIVQGKCGKCLQQPICPLGTKQLGKEMKKCIYTLYFMG
QRSPFIGCRPVCVKTVIMRECCAGFFGPQCQPCPGKAGDVCFGNGICLDGVNGTGMCECG
EGFNGTACETCNEGRYGIHCDQVCPCVHGRCNQGPFGDGSCECDVGWRGIRCDSEITKDN
CNGTCHTSANCLLNSDGTALCKCAAGFQGNGTVCTAINACEISNGGCSANADCKRTTPGR
RLCVCKVGYAGDGIMCLEINPCLENHGGCDKNAECTQTGPNQAVCNCLPKYTGDGKSCTL
INICLTENGGCSEFAICNHTGQDERTCTCKPNYTGDGFTCRGNIYQELPKNPKTSQYFFQ
LMEHSVRDLVGPGPFTVFAPLSAAFDKEARVADWDKQGVMPQVLRYHVIACHQLLLENLK
LTPNATSLQGESIAISVSQDTVYLNNDTKVISSDIISTNGVIHIIDKLLSPKNLLIAPRD
ASGRILQNLTTVAKNHGYTKFSNLIQDAGLLNLITDPIHIPVTLFWPTDQALQALPTQQR
DFLFNQENKDKLKEYLKFHVIRDSKVLAVDLPRSAAWKTLQGSELSVKCGASSEIGELFL
NGQTCRIVQRNLLFDLGVAYGIDCLLIDPTLGGRCDTFASFNISGSCGSCVSTPACPRGS
KSKGVKQKCLYNLPFKRNVEGCQQQCIMVVQLPRCCKGYFGRDCQACPGGPDAPCNNRGV
CLDEYWATGECQCNIGFNGTACERCWPGRFGPDCQPCGCSDHGQCDDGILGSGQCLCETG
WTGRFCDTQTVLPPECTPACSTHATCKENNTCECNLNYEGDGITCTVVDFCKQNNGGCEK
VAKCSQKGTKVSCSCPKGYKGDGYSCTAIDPCADGLDGGCHEHATCKMTGPGRRKCECKS
HYVGDGLNCEPEQLPVDRCLQDNGQCHPDADCADLHFQDTTVGVFHLRSPLGQYKLTFDK
AREACMNEAATMATYNQLSYAQKAKYHLCSAGWLETGHVAYPTAYAAQSCGSGIVGIVDY
GIRTNKSEMWDVFCYRMKDVNCTCKVGYVGDGFLCSGNLLQVLMSLPSLKNFLTEVLAYS
NSSARGQAFLKHLTDLSIRGTLFVPENSGLGENETLSGRDIEHHLANVSLIFYNDLVNGT
ILRTRLGSQLLITSSQDQLYKETRFVNGRAILQWDIFASNGIIHVISGPLKAPPAPETSA
HTGLGTGIFFAIILVFGAIAFAAYSYFRLSQRTIGFQHFEQKRISMLQLSARSSLRISQT
PRTRIPPQLPQNPPTTP
Download sequence
Identical sequences G3TI35
ENSLAFP00000014285 ENSLAFP00000014285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]