SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TJF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TJF3
Domain Number 1 Region: 196-323
Classification Level Classification E-value
Superfamily C-type lectin-like 6.7e-41
Family C-type lectin domain 0.00025
Further Details:      
 
Weak hits

Sequence:  G3TJF3
Domain Number - Region: 66-223
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00136
Family HBL-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TJF3
Sequence length 329
Comment (tr|G3TJF3|G3TJF3_LOXAF) CD207 molecule {ECO:0000313|Ensembl:ENSLAFP00000014855} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=CD207 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
RMTAGEELPCAHFEVDKQNISLWPREPPSKMDRPLALRKPSTLCAVLTFLTLVLVTSILL
QSILYSWLLGTISDVRINAQLLKGRVDNISTEGSEIKRNQGGLKTASVQIQRVNVSLNHV
HSQLLTLETGLEKANAQIQMLTKSWEEVDALNAQIPELKRDLDKASVLNAKVRGLQSSLE
NMGKSLRQQNDILQMVSQGWKYFKGNFYYFSRVQKTWYSAQQFCKSRNSQLTSVTSESEQ
EFLYKTAGGISYWIGLTKAGSEGDWSWVDDTPFNKVQSAKFWIPGEPNNSGYSEHCAHIR
MASLQSWNDASCDNTLPFICKQLYIPSEP
Download sequence
Identical sequences G3TJF3
ENSLAFP00000014855 ENSLAFP00000014855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]