SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TK51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TK51
Domain Number 1 Region: 355-565
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-49
Family DBL homology domain (DH-domain) 0.00068
Further Details:      
 
Domain Number 2 Region: 547-679
Classification Level Classification E-value
Superfamily PH domain-like 7.45e-29
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 808-904
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-23
Family Pleckstrin-homology domain (PH domain) 0.0006
Further Details:      
 
Domain Number 4 Region: 659-773
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.97e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TK51
Sequence length 946
Comment (tr|G3TK51|G3TK51_LOXAF) FYVE, RhoGEF and PH domain containing 1 {ECO:0000313|Ensembl:ENSLAFP00000015169} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=FGD1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MHGHRAPGGAGPSEPEHPAANPPVAALPACADSYLGVSEPGLPVPRGSASALCGPLDSQL
AGPSDASSGAAPGPRVLPCRPSPQHHRALRFSYHLEGLQPRPGLHQGNRILVKSLSLDPG
QSLEPHPEGPQWLRSDPGPPTETPSQRPSPLKRAPGPKPQVPPKPSYLQMPRMLPPPEPI
PPPPSRPLPADPRVAKGLAPRVEAGPSSAAVSSLIEKFEREPVIVASDRPALGPSPGPIE
PASQPPVPALPEGEASRCLFLLAPGPRDGEKMPNRDSGIDSISSPSNSEPEYLLCQNQAQ
VWGLRPGSAGMADIFILFCFPYTPGTQKAFPDNELRGRMVEDDGSRVTYSPSQLTVQQKV
FHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNRSSFPADVVHGIFSNICSIYCFHQQ
FLLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVELVNTWTERSTQFKVI
IHEVQKEEACGNLTLQHHMEPVQRIPRYELLLDYLLKLPHGTQDKGSSEEESLELIATAA
EHSNAAIRKMERMHKLLKVYELLGGEEDIVSPTKELIKEGHILKLSAKNGTTQDRYLILF
NDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESSNLNLPRTFLVSGKQRSLELQARTEE
EKKDWVQAINSTLLKHEQTLETFKLLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTM
CMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLIYDNNRSNRVCTDCYVALHGVPGS
NPACNQHTPQRRRSILEKQASVAAENSIICSFLHYMEKGGKGWHKAWFVVPENEPLVLYI
YGAPQDVKAQRSLPLIGFEVGPPEAGERPDRRHVFKITQSHLSWYFSPETEELQQRWMDV
LGRAGRGDTFCPGPTLSEDREMEEAMVAASGATAEPPEGSPDPRKL
Download sequence
Identical sequences G3TK51
ENSLAFP00000015169 ENSLAFP00000015169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]