SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TKC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TKC3
Domain Number 1 Region: 15-134,326-634
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.09e-69
Family Integrin alpha N-terminal domain 0.000058
Further Details:      
 
Domain Number 2 Region: 154-349
Classification Level Classification E-value
Superfamily vWA-like 1.17e-52
Family Integrin A (or I) domain 0.0000000235
Further Details:      
 
Domain Number 3 Region: 919-1120
Classification Level Classification E-value
Superfamily Integrin domains 3.98e-39
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 4 Region: 777-914
Classification Level Classification E-value
Superfamily Integrin domains 3.45e-25
Family Integrin domains 0.0049
Further Details:      
 
Domain Number 5 Region: 637-776
Classification Level Classification E-value
Superfamily Integrin domains 8.63e-20
Family Integrin domains 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TKC3
Sequence length 1166
Comment (tr|G3TKC3|G3TKC3_LOXAF) Integrin subunit alpha 2 {ECO:0000313|Ensembl:ENSLAFP00000015263} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ITGA2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
FLFFLIGILNCCVAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPEN
RMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLTRNVGTGGFLTCGPLW
AQQCGNQYYTTGVCSEVSPDFQHLASFSPAVQTCPSFIDVVVVCDESNSIYPWDAVKSFL
EKFVQGLDIGPQKTQVGLIQYGNNPRVVFNLNTYKTKAEMIKATTRTYQHGGDLTNTFKA
IQYARDFAYSAAAGGRPHATKVMVVVTDGESHDGSMLKAVIEQLNNDNILRFGIAVLGYL
NRNTLDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSIEGTVQGGDNFQ
MEMSQVGFSADYSPQNDILMLGAVGAYAWSGTIVQQTSRGHLIFPKQAFDQILQDRNHSS
YLGYSVAVISTRKNIHFVAGAPRANYTGQIVLYRVDENGNVTIIQPHRGDQIGSYFGSVL
CSVDVDRDTITDVLLVGAPMYMNDLKKEEGRVYLFTITKGILNHHQFLEGPEGFENARFG
SAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQSTIRTKYSQKILGSDRAFRSHL
QYFGRSLDGHGDLNGDSITDVSIGAFGQVVQLWSQSIADVSVEAFFTPEKITLLKKNAEI
ILKLCFSAKFRPTNQINQVAITYNVTLDADRFSSRVTSRGLFKENNERFLQRNMVVNQAQ
SCSEHIIHVQEPSDVVNPLDLRVNISLENPGTSPALEAYSETAKVFRIPFYKDCGDDGLC
ISDLVLSVQQLPADQKQPFIVSNQHKRLTFSVTLKNKKESAYNTRIVAAFSENLFFASSS
MPVDGTEVTCQVDSSQKSVTCNVGYPALKRKQQVTFTVNFDFNLQNPQNQASVSFQALSE
SHEENQADNLVTFKIPLLYDADIHLTRSTSINFYEVSSDGKVPSIIHDFEDIGPKFTFSL
KVTTGGAPVSMAYVTIHIPQYTKEKNPLMYLTGVQTDQAGDIGCNAEINPLKIGQASSSV
SFKSENFRHMKELNCRTASCSSVTCWLKDLQAKGEYFVNVSTRIWNGTFAASTFQAIQLT
GSAEIDTYNPQIYVIEENTVMIPVIIMKPGEKAEVPTGVIVGSIIAGILLLLALVAILWK
LGFFKRKYEKMTKNPDEIDEMTEINS
Download sequence
Identical sequences G3TKC3
ENSLAFP00000015263 ENSLAFP00000015263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]