SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TKW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TKW2
Domain Number 1 Region: 436-565
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 627-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000457
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 661-701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000553
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 729-853
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000235
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 5 Region: 372-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 336-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 7 Region: 295-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 706-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  G3TKW2
Domain Number - Region: 591-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00041
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 868-894
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00392
Family PMP inhibitors 0.0039
Further Details:      
 
Domain Number - Region: 412-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00879
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 262-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0482
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TKW2
Sequence length 1214
Comment (tr|G3TKW2|G3TKW2_LOXAF) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=JAG1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MRSPQTRGRPGRPLSLLLALLCALRAQVCGDLCSRVEILSMQNVNGSCRGNCCGGARSPG
DRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVL
PFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQ
IRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKH
GSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCVEPWQCLCETNWGGQLCDKDLNYCGT
HQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNGGSCKETSLGFECGC
SPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQIDANECEAKPCV
NAKSCKNLIGGYYCDCLPGWMGQNCDININDCRGQCQNDASCRDLVNGYRCICPPGYAGD
HCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQSDVDYCEPNPCQNGAQCYN
RASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPH
GKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWEGA
YCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYD
EGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVSTGSFTCVCKEGWEGPCTQNTN
DCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRC
VCPPGHSGAKCQEVSGRPCITVGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLL
HKGHGECPSGQSCVPILDDQCFVRPCTGIGECRSSSLQPVKTKCTSDSYYQDNCANITFT
FNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSATANNEIHVAISAEDIRDD
GNPIKEITDRMIDLVSKRDGNSSLIAAVAEVRVQRRPMKSKTDFLVPLLSSVLTVAWICC
LVTAFYWCVRKRRKPSSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPVKDYENKNS
KMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPAKHPNWTNKQDNRD
LESAQSLNRMEYIV
Download sequence
Identical sequences G3TKW2
ENSLAFP00000015484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]