SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TL88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TL88
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-35
Family Galectin (animal S-lectin) 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TL88
Sequence length 172
Comment (tr|G3TL88|G3TL88_LOXAF) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LGALSL OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
VCGGLLDSSRLVKLDDGHLNNSLGSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIV
DLNPESFAISLTCGDSEDPPADVAIELKAVFTERQLLRNSCISGERGEEQSAIPYFPFIP
DQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQLTKLG
Download sequence
Identical sequences G3TL88
ENSLAFP00000015639 ENSLAFP00000018258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]