SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TLI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TLI2
Domain Number 1 Region: 84-225
Classification Level Classification E-value
Superfamily C-type lectin-like 1.22e-34
Family C-type lectin domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TLI2
Sequence length 227
Comment (tr|G3TLI2|G3TLI2_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000015761} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MNNQTVTYSEVNLAKNPKRQQIKPKDADSSISVTEQEITYVELNLHGASQDLQKNDKNFC
CKDLPSPPGKFVAGILGIICIVLMASVVTVAVIVVTPLIHILFSAYHCGHCPGDWLSYSN
NCYYVSSDKKTWTESQMACASKKSNLIYIDNEEEMKFMDILSSYSWIGLSRESSDHSWLW
KNGSPLKQKIRETSNPMYNCAMLVSSDLQSASCGSETTYICKLEISS
Download sequence
Identical sequences G3TLI2
ENSLAFP00000015761 ENSLAFP00000015761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]