SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TM85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TM85
Domain Number 1 Region: 4-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000246
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TM85
Sequence length 111
Comment (tr|G3TM85|G3TM85_LOXAF) Neuregulin 4 {ECO:0000313|Ensembl:ENSLAFP00000016190} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NRG4 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
VVDHEEPCGLNHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTKSDL
SVIFVVLAVLGTLIIGAFYFLCRKSHLQRASSAPYDISLVETSNTSAQDSE
Download sequence
Identical sequences G3TM85
ENSLAFP00000016190 ENSLAFP00000016190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]