SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TMV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TMV2
Domain Number 1 Region: 152-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.72e-50
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 376-508
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-21
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TMV2
Sequence length 793
Comment (tr|G3TMV2|G3TMV2_LOXAF) Pleckstrin homology and RhoGEF domain containing G6 {ECO:0000313|Ensembl:ENSLAFP00000016484} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=PLEKHG6 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MQTFGPPDEGPLQGLVASLIETYGGRHRASTQSTAGSLYPRGGAVPDPSRRLLQNYVPFV
KSSGQTRGLAPIWLREPEPEKRHGGHLGAGTPHSPKLKEVTKAHELKVRLHTFSMFGMPR
LPPEDRRHWEIGESSDSGLAIEKTWRELVPGHKEMSRELCHQQEALWELLTTEVIYVTKL
KIMTDLLAAGLLNLQRVGLLTEVSVETLFGNVPSLIRAHRGFWEEVLGPTLEETRASGQP
LDPVSLQNGFLTFGQRFHPYVQYCLRVKQTMAYAREQQENNPLFQIFVQWCEKHKRSGRQ
MLGDLLIKPHQRITKYPLLLQAVLKRSPEARAQEALNTMIASVESFLRYINRQVRQGEEQ
ESLVAVAQRIGPYEVLEPSSEEVEKNLRPFSTLDLTSPMLGVSPEHTRQLLLEGAVRVKE
GREAKLDVYLFLFTDVLLVTKPQRKADKAKVIRPPLMLEKLVFRPLRDPSSFLVINLTEF
QCVSSALIVYCPSSTDRAQWLEKTQKAQATLQKLKIEEYVQQKRDLLALYRDRDRDQESP
GTRPSTPSPEGSQGSAEGRAPEFSTIIPHLVVTEDTDEDAPSAPDDTSDSGYSTLIPGSP
KGPRSPLSRQRQRALRRDPRLTFSTLDLRNVPLRPQPPNSQAPQRRSAPDLPEEGIQRGS
SLPKGDPPTWSEEEDGTSGGGNAGVGTLHRARLRGQLSPSPIHVDSAGESPWDSSGDEDE
ESLFLEPSHVPSPRPLQAEDMLRQIREELASQRVEDAPEPPSARPRKLTRLQLQRMRGPH
IIQLDTPLSTSEV
Download sequence
Identical sequences G3TMV2
ENSLAFP00000016484 ENSLAFP00000016484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]