SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TNU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TNU4
Domain Number 1 Region: 76-197
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-33
Family Pleckstrin-homology domain (PH domain) 0.00072
Further Details:      
 
Domain Number 2 Region: 201-299
Classification Level Classification E-value
Superfamily Immunoglobulin 6.71e-23
Family I set domains 0.0054
Further Details:      
 
Domain Number 3 Region: 292-389
Classification Level Classification E-value
Superfamily Immunoglobulin 2.25e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 11-66
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000301
Family DBL homology domain (DH-domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TNU4
Sequence length 834
Comment (tr|G3TNU4|G3TNU4_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000016970} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
SAADPSQPPPPPLQHYLEQPIERIQQYQTLLKDLIRNKARNRQNCALLEQAYAVVSALPQ
RAENKLHVSLMENYPGTLEALGEPIRQGHFIVWEGAPGARMPWKGHNRHVFLFRNHLVIC
KPKRDSRTDTFSYVFRNMMKLSSIDLNDQVEGDDRAFEVWHEREDSVRKYLLQARTVIIK
NSWVKEICGIQQRLALPIWRPPDFEEELADCTAELGETVKLACRVTGTPKPIVSWYKDGK
TVEVDPHHILIEDPDGSCSLILDNLTGMDSGQYMCFAASAAGNASTLGKILVQVPPRFVN
KVRAAPFVEGEDAQFTCTIEGAPYPQIRWYKDGALLTPGSKYQMFSEPRSGMLVLEIRAA
SQGNLGYYECELVNRLGSARGGAELYMQSPALRAREQPRREQLVAVEVTEQETKVPKKTV
IIEETITTVVKSPRGRRRSPSKSPSRSPSRRSASPPRLVMLTPDLRYSSGAGQPPRPEVE
LGRMHTVPTLYVTEVEAPSPAPPSSPEPQPKWVEVEETIEVRVKKTGTRGASPAREAASS
SGGLAFTLPGLAHGEDPNTNNSNNKLLAQEAEAQGRAGGPWPRPGSPPVVCIGEPFVFCV
DAGGSVDWTAPGTGSPEAETEAPCEVPPPWAAEEKPEMPFESVVEGGEEGDACVIEEPQD
TEGLWGRDPKILTHHGHQLTLADLEDYVPREGETFGCGGSVPTTSNDSPPCEVSVLQTEI
SEPTVGQPVLLAVGHPPGSRGPPSFFSHASQPRTCERPLLGTQARDPARVSFGVQGAWPG
KTSFCTQVQHTVDSGQGSFKMEVSTQTVSFGTVGETVTLHIRPDGDEATTPPQS
Download sequence
Identical sequences G3TNU4
ENSLAFP00000016970 ENSLAFP00000016970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]