SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TPM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TPM4
Domain Number 1 Region: 77-287
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-61
Family DBL homology domain (DH-domain) 0.0000000651
Further Details:      
 
Domain Number 2 Region: 272-428
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-47
Family Pleckstrin-homology domain (PH domain) 0.00000267
Further Details:      
 
Domain Number 3 Region: 2-50
Classification Level Classification E-value
Superfamily SH3-domain 6.83e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TPM4
Sequence length 489
Comment (tr|G3TPM4|G3TPM4_LOXAF) Rho guanine nucleotide exchange factor 4 {ECO:0000313|Ensembl:ENSLAFP00000017359} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ARHGEF4 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MDDQELGFKAGDVIEVMDATNREWWWGRITDGEGWFPATFVRLRVNQDEPADDEAHQVQE
DGRVADGEAEEGSLVQSSKDQMRTNVINEILSTERDYIKHLRDICEGYIRQCRKRADMFS
EEQLRTIFGNIEDIYRCQKAFIKALEQRFNRERPHLSELGACFLEHQADFQIYSEYCNNH
PNACVELSRLAKLSKYVYFFEACRLLQRMIDISLDGFLLTPVQKICKYPLQLAELLKYTP
PQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEGEDLLVRSSELIY
SGELTRILQPQAKSQQRMFFLFDHQLIYCKKDLLRREVLYYKGRVDMDRLEVVDVEDGKD
RDLHMSIKNAFRLCCSTTGESHLLCARKPEQKQRWLKAFVSEREQVRLDQETGFSITELQ
RKQAMLNASKHRAAGKPKATSRPYYLTRQKHPALPAGLPPQQQVLVLAEPKRKPSTFWHS
ISRLTPFRK
Download sequence
Identical sequences G3TPM4
ENSLAFP00000017359 ENSLAFP00000017359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]