SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TR91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TR91
Domain Number 1 Region: 53-505
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.49e-93
Family Integrin alpha N-terminal domain 0.0000000014
Further Details:      
 
Domain Number 2 Region: 506-664
Classification Level Classification E-value
Superfamily Integrin domains 2.51e-44
Family Integrin domains 0.0000157
Further Details:      
 
Domain Number 3 Region: 665-799
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-35
Family Integrin domains 0.0000125
Further Details:      
 
Domain Number 4 Region: 806-877
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-24
Family Integrin domains 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TR91
Sequence length 877
Comment (tr|G3TR91|G3TR91_LOXAF) Integrin subunit alpha 8 {ECO:0000313|Ensembl:ENSLAFP00000018099} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ITGA8 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
LGSRSPVSVRRGRRAMSARARCGLAGSRAQPLAPLWCFSAALGMLWSPVSQAFNLDVERL
TVYSGPDDSYFGYAVDFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQC
KQIPFDTTIGSRFLDNRKIRVNGTKEPIEFKSNQWFGAAVRAHRGNVVACAPLYHWRTLK
PTSEKDPVGTCYVAIQNFSAYAEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPG
SFYWQAQQLVFLSQQYIIANYSFKDILRKLAREKQTDVAPASYDDSYLGYSVAAGEFTGD
SQQELVAGIPRGAQNFGYVSIINSTDMTFIQNFTGEQMASYFGYTVTVSDVNNDGMDDIL
IGAPIFMEREFESNPKEVGRVYLYLQSSPLIFRDAQVLTGTKVFGRFGSAVAHLGDLNQD
GYNDIAIGAPFAGKDQQGKVLIYNGNKDGLNIKPSQILQGAWASQAVPSGFGFTLRGDSD
IDKNDYPDLLVGAFGTGKVVVYRARPVVTVDAQLLLNPVIINLENKTCQIPDSMTSVACF
AVTVCASVAGQSISNTIALTAEVQLDSLKQKGAIKRTLFLDNHQSHLIFPLVIRRQKALQ
CQDLIVYLRDETEFRDKLSPINISLNYSLDESIFKEGLAVKPILNYYRVNAVSEQAHILV
DCGEDNICIPVLKLSARPDKDQVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYV
GIERSNKGLRPLSCEYKMENVTRMVVCDLGNPMVAGTNISLGLRFAVPRLEKTNVSINFD
LQIRSSNKDNPDSNFVSLQINITAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHREEEVGP
LVEHIYEMHNTGPSTISETLLEVGWPFSSRGEFLLYI
Download sequence
Identical sequences G3TR91
ENSLAFP00000018099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]