SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TS95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TS95
Domain Number 1 Region: 320-490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-62
Family SPRY domain 0.00000955
Further Details:      
 
Domain Number 2 Region: 41-151
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-20
Family V set domains (antibody variable domain-like) 0.00024
Further Details:      
 
Domain Number 3 Region: 167-239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000388
Family C1 set domains (antibody constant domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TS95
Sequence length 542
Comment (tr|G3TS95|G3TS95_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000018453} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
PAVMTKTCFQDAFLPSCFIILIFLQLLPTVVHGNGNVTFDVIGPNEPILAIVGKGADLPC
HLSPNISAKDMELRWYRDKFSPAVYVYERGKNVSGEQMEEYRGRTTFLIDHIANGTAAVR
IHNVTVFDNGTYHCYFQEGTRHGEATLWLKVVGLGSQPRIRLRDDKEEGVQVECTSAGWY
PQPQVEWRDFRGKIIPSVANLSVSPTSGLFAVVSNVVITDRAMEGLYCSIANPLLFKEKL
TVSLVPASFSRSVWPKVWRISLPLILMALGLVVAGAICISWKKLRDEAELKTGKWGSRKV
FFNEVKVRCNRGHKALRRGSLSLDPDTANPKLELSKDLKSVSRLLFTQDLPDNPERFNKD
PCVLGQEQFTRGKHYWEVEVGNRKAWNLGVCLESLNRKGRIPKSPKHGLWAVEFYKEELW
ALTFPRIHLHPSQPLQRVGIFLDYEAGNISFYNGADGSHVYTFSGVSFSGPLRPFFCLWL
YDRSPLTICSGSRETGEVSGPLQVSELHQEASVTPVIERAAAFSKDREPPLKRPMFSPQS
SP
Download sequence
Identical sequences G3TS95
ENSLAFP00000018453 ENSLAFP00000018453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]