SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TSE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TSE9
Domain Number 1 Region: 102-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-53
Family DBL homology domain (DH-domain) 0.0000783
Further Details:      
 
Domain Number 2 Region: 327-446
Classification Level Classification E-value
Superfamily PH domain-like 1.58e-20
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TSE9
Sequence length 542
Comment (tr|G3TSE9|G3TSE9_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000018507} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NET1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MVAHDEIGGLLPIKRTIRVLDVNNQSFREQEEPSNKRVRPLARVTSLANLISPVRNGAVR
RFGQTIQSFALRGDNRSPASAHKSYSRSTVPTPAKRRNSVLWSEMLDVSMKESLTTKEIK
RQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLA
RIGEATKPDGTVEQIGHILVNWLPGLNAYKVYCSNQLAAKALLDQKKQDPRVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLVKYPLLIKEVLRHTPKDHPDVQLLEEAVLIIQGVLSDIN
LKKGESECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELKNKNGHKLYIFLFQDILVLTR
PVTRNERHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSDKAKNIFRVRFQDPS
PGQSHTLQANDVFHKQQWFNCIRTAIAPFQQATSPTELKDLPELSEECEENNLSASNVKA
QRRVSTVSSVVQVEVDENASEYGSSVQTAEDTKSVKVHRTQSGFRKARDKAQLSGKRKET
LV
Download sequence
Identical sequences G3TSE9
ENSLAFP00000018507 XP_003410647.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]