SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TTA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TTA1
Domain Number 1 Region: 183-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000235
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 2 Region: 145-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 63-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000641
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 4 Region: 105-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000195
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  G3TTA1
Domain Number - Region: 6-30
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00679
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 30-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00804
Family Integrin beta EGF-like domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TTA1
Sequence length 355
Comment (tr|G3TTA1|G3TTA1_LOXAF) Delta like non-canonical Notch ligand 1 {ECO:0000313|Ensembl:ENSLAFP00000018809} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=DLK1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
PACHPIHGSCVDENICRCHPGWQGPLCDHCVPSPGCVNGICFEPGQCVCNEGWEGHLCDI
DVRPCTSNPCANNSTCVDLDTGGYECSCGQGYTGSHCQEKKPGPCVINGSPCQHGGTCVD
DEGLASHASCLCPPGFSGIFCEIVANNCTPNPCENNGVCTDIGGDFRCRCPAGFIDKTCS
RQVTNCTSNPCQNGATCLQHAQVSFECLCKPEFTGPTCAKKRVPSPQQITRQPYGYGLTY
RLTPGVHELPVAQPEHHILKVTMKELNQSSPLLTEQAICFTILGVLTGMVVLATVGVVLI
NKCEAWVSNRYNRMVRKKQNVLLQYHAGEELAVNIIFPEKIDTTTFDREAGDEEI
Download sequence
Identical sequences G3TTA1
ENSLAFP00000018809 ENSLAFP00000018809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]