SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TTF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TTF1
Domain Number 1 Region: 153-349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-38
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 12-82
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000303
Family RING finger domain, C3HC4 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TTF1
Sequence length 352
Comment (tr|G3TTF1|G3TTF1_LOXAF) Ring finger protein 39 {ECO:0000313|Ensembl:ENSLAFP00000018859} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=RNF39 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MEAPALGSGLVERLEQLATCPLCGGPFKDPVLLACEHSFCRACLALRWGPPPATGTAATP
TACPCCGRPCPRRSLRSNVRLAVEVRISRGLCEKLAEPGARAVRRRGGRIPTMGWLDPPG
EDMRKTWSRFDAPMPKSPNSEDDLPEDYPVVKNMLHRLTADLTLDPGTAHRHLVISSDCR
SVRLAPPGTPAPPDSPARFDQLPAVLGAQGFGAGRHCWEVETTDTVSREDSSGEDEDDGE
SRYAVGAAGESVRRKGRVGLCPAGAVWAVEGRGGRLWALTAPEPTLLGGAGPPPRRIRVD
LDWERGRVAFYDGRSLDLLFAFQAPGPLGERVFPLLCTRDPRAPLRIVPAEG
Download sequence
Identical sequences G3TTF1
XP_010599504.1.64505 ENSLAFP00000018859 ENSLAFP00000018859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]