SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TUP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TUP1
Domain Number 1 Region: 39-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-40
Family Laminin G-like module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TUP1
Sequence length 485
Comment (tr|G3TUP1|G3TUP1_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000019299} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
LVSRFRWQKVSPGRGASRCAPLPLLWLILPLPPLISAQPADLLKVLDFHNLPDGITKTTG
FCATRRSSKGPDVAYRVTKDAQLSAPTRQLYPASAFPEDFSILATVKAKKGSQAFLVSIY
NEQGIQQIGLEMGRSPVFLYEDHTGKPGPEDYPLFRGINLSDGKWHRVALSIHKKNVTLV
LDCKKRTTKFLDRSDHPIIDVNGIIVFGTRILDEEVFEGDIQQLLFVADHRAAYDYCEHY
SPDCDTAVPDTPQSQDPNPDEYLPNNEYPLPVQIGLMSQGPEPRPLLQTQESAGENFKYI
REELTLPPTEAPTVPETREGPGKEDDPGIGDYDYVPSEDYYTPSPYEDINYGEGIENPDQ
PTDPGPAAEFPTSTEATTNVSSPALSPEEGKDDFDGEFTEETIKNLDENYYDPYFDPTIS
PSEIGPGMPANQDTVYEGIGGPRGEKGQKGEPAIIEPQALFLQNSFVPERPSGPGPGMGC
VGPTG
Download sequence
Identical sequences G3TUP1
ENSLAFP00000019299 ENSLAFP00000019299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]