SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TUV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TUV2
Domain Number 1 Region: 10-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-33
Family Laminin G-like module 0.0027
Further Details:      
 
Weak hits

Sequence:  G3TUV2
Domain Number - Region: 225-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000143
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TUV2
Sequence length 279
Comment (tr|G3TUV2|G3TUV2_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000019360} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MGTALVQRGGCFLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMTFQLKT
RSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIR
RQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAATLKLTLAAVREREPF
KGWIRDVRVNSSQALPVDSGDVKLDEEPPSSGGGSPCEGGEEGEGGVCLNGGVCSVVDDQ
AVCDCSRTGFRGKDCSQVKKSLAVLSHLTLGEEKGKASR
Download sequence
Identical sequences G3TUV2
ENSLAFP00000019360 ENSLAFP00000019360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]