SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TWY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TWY1
Domain Number 1 Region: 1308-1368
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000249
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 990-1166
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000942
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TWY1
Sequence length 1378
Comment (tr|G3TWY1|G3TWY1_LOXAF) RUN and SH3 domain containing 2 {ECO:0000313|Ensembl:ENSLAFP00000020089} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=RUSC2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MDSPPKLTGETLIVHHIPLVHCQVPDRQCCVGASGGGGSTRPNPFCPSELGITQPDQDLV
QADSLLYNSLHSAPGGLARSTDSTKSRGRDGRGSGAPKRRNPFLLQEGVGEPGLGDLYDD
SIGDSTTQQSFHLHGVGQPPFHLSSFQLPPTGPGVGRPWGTTRSRAGVVEGQEQEPVTTL
DTQHCSIRHCCRPELEAETMELDECGGPGGSGGGASDTSGFSFDQEWKLSSDESPRNPRC
SGSVRQHCRCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKMHGNSRANLNSA
PQTYSDSSFCSHSDPGTFYLDLQPSPAESKMSCESHLPDSGGREGGYGCPHASSPELDAN
CNSYHPHCEPCPAMADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSVTSCSE
EPTKISPTPGPGPEPGPSQPSEYYLFQKPEIQPEEQEALGSSAEAVAAVGPTVMEGQVYT
NTSPPNLSTGRQRSRSYDRSLERSPPVRLGSLERMLSCPVRLSEGPAALAGPSSLPKRVT
SFAELAKGRKKAAGSGSPPLRVSVGDSSQEFSPIQEAQQDRVGPPDEGTRCSHSLPPIPL
GPSVDLVGPESWSTQVCQGPQSSEMPPAGLRAAGQDPVAQLMDPGPALPGTPTNSHTQRD
ARARADGKFPKSQDVLHSDPLLFPDLIPLPQSLFWEFSRKSVDSGCSETSLSQRYSASSC
SFGYQHLPRWLPHCSSPAPAPSGEPLGSTSRTTDRGAKKAGPEPETSRPSPLGSYSPIRS
AGPFGPSTDSSASTSCSPPPEQATAIESPPLWSHSCPPAARPATFQQPQKEDQKILTLAE
YRLHGTGSLPPLGSWRSGLSRAESLTRGGSEGSMASRPSNANHLSPQALKWREYRRKNPL
GPPGLAGSLDRRPQEARLSRRNPIFEFPGSLSAASHLNCRLNGQVVKPLPLTCPDFQDAF
SLTEKPPAEFCLSPDGNSEAISIDLLQKKGLVKAVNTAVDLIVAHFGTSRDPGVKAKLGN
SSVSPNVGHLVLKYLCPAVRAVLEDGLKAFVLDVIIGQRKNMPWSVVEASTQLGPSTKVL
HGLCNKVSQFPELTSHTMRFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHYQPWGFLSAA
HTVCPGLFEELLLLLQPLALLPFNLDLLFQHRLLQSGQQQRQHKELLRVSQDLLLSAHST
LQLARARGQEGPGDLDRTAHGERVKGVGAPEGGEEEEETEEVAEAAQGSGQGRWARGGQA
GWWYQLMQSSQVYIDGSTEGSRFPRGEKKKGAGGGGFGFRWGFLTSVCYFPSEVQALCHH
LATGPGQLSFHKGDILRVLGPAKGDWLRCSRGPDTGLVPLAYVTLTPTPSPTPGSSQN
Download sequence
Identical sequences G3TWY1
ENSLAFP00000002052 ENSLAFP00000020089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]