SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TX08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TX08
Domain Number 1 Region: 41-220
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-44
Family DBL homology domain (DH-domain) 0.0000381
Further Details:      
 
Domain Number 2 Region: 230-346
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-33
Family Pleckstrin-homology domain (PH domain) 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TX08
Sequence length 469
Comment (tr|G3TX08|G3TX08_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000020116} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
RGFCSPIFSSCHLSSVSGSISPGAAAAHGAPGGAHAQILSRLYHIMAEMVSTEREYVRSL
GYVIDNYFPEMERVDLPQDLRGKRGTIFGNLEKLHDFHRQHFLRELERCRHCPLAVGLGF
LKHEEQFRMYALYSKNKPRSDALLSSHGNAFFKAKQQALGDKMDLASYLLKPVQRMSKYA
LLLKDLVKEASRSSTQEQDLSQLQAAEDMVCFQLRHGNDLLAMDAVRGCDVNLKEQGPLR
CQDEFVVYCGRRKYLRRVFLFEDLILFSKTKKMDGGYDIYVYKQSFKTAEIGMTENVGDS
GLRFEIWFRRRRRRSQDTYILQASSAEMKTAWTSIIGRILWRQALRNRELRMREMVSMGL
GNKPFMDIKPSDAAISDRAIDYTMKGTESWSRASIAVSSFDHTTPFKRPHSTISDSSTSS
SSSQSSSVLGSLNLHVYSGLPGLLSPALWPWPYDEEELEQNTGSQPSMS
Download sequence
Identical sequences G3TX08
ENSLAFP00000020116 ENSLAFP00000020116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]