SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TXD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TXD9
Domain Number 1 Region: 1128-1304
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.33e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00085
Further Details:      
 
Domain Number 2 Region: 685-805
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.0018
Further Details:      
 
Domain Number 3 Region: 445-572
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-27
Family Pleckstrin-homology domain (PH domain) 0.0000132
Further Details:      
 
Domain Number 4 Region: 912-1043
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-22
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 5 Region: 1437-1572
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-19
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 6 Region: 7-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.09e-17
Family SAM (sterile alpha motif) domain 0.0000598
Further Details:      
 
Domain Number 7 Region: 583-684
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000101
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 8 Region: 1020-1120
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000938
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3TXD9
Sequence length 1717
Comment (tr|G3TXD9|G3TXD9_LOXAF) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSLAFP00000020247} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ARAP2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MTSVSEINVDIKDFLMSINLEQYLSHFRDFGLNTVKDCAAINDSLLHKIGISPTGHRRRI
LKQLQIILSKMQDTPIYANVHKTKKNDKTSENSHALSSDSCIELSDSGSAHTPSPVHLET
VTKHLDQNDVSVESSQSLKSDDKLYLPVHSVPLPKEPHLDLGSSQDSSLGSENFKTESLI
TKKTVDCTIKEQQTERADLTSENLSKLPNSDPECRSSPGFSISEASSGNGTNGLLAKPPP
SPFFQFQGEMVVNDLYVPSSPNLAPVRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGISGS
YLRERRNVTTSAGKFVAQQNSSEENSSSIFPYGETFLFQRLENSKKKSIKNEFWTHEETL
KRETTTESKNNLLVVSSIYDNRTEKTSEDKVEDIWIPREDKNNVLIDSASESEYSTVEEC
FHSLRRKNSKAPKSRTQKVLNLDPLTRHSYPCSSPSGNADSSTLPSYAISPYACFYGSPA
RRIKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAVSTVRVQGDN
KFEVVTTQRTFVFRAEKEEERNDWISILLNALKSQPLTSQSQAVVAPEKCGYLELRGYKA
KIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTA
ESEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICK
KCAGQHRSLGPKDSKVRSLKMDASIWSNELIEVRKFGFLLALGNKRPKDFWAGNLPKDEE
LHMDSPVEKRKSFITQKYREGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGA
DVMCATGDPVYSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIPSEGGLSQEFSQSTFLC
DFLYQAPSAASKLSSEKKLFEETNKKWCVLEGGFLSYYEHDKSTTPNGTININDVICLAI
HKEDFYLSTGPIFTFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPFVAENLTEADYD
LIGQLYYKDCHALDQWRKGWFAMDKSTLRFCLQMQEAQEDRMHLRRLQELTISTMLQNGE
KLDVLLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCI
AFVTQYGLGCKYIYQKNGDPLCISELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDI
DDALLTKELYPYWVSALDTQDDKERIKKYGTFIRNLPTVNRATLAAIIEHLYRVQKCSEI
NHMNAHNLAMAFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEEQVKQMDIENSFITK
WKDTQVSQAGDLLIEVYVERKEPDCSIIIRISPIMEAEELTNDILAIKNIIPKKGDVWAT
FEVIENEELERPLHYTENVLEQVLQWSSLAEPGSAYLVVKQFLTIDTIRHYSERSALESI
KEGVLKIKEEPSKILSGNKFQDRYFVLRDGYLFLYKDLKSSKHDKMFSLSSMKFYLGVKK
KMKPPTSWGLTAYSEKHHWHLCCDSLQTQMEWMASVFIAQHENDIWPPAGKERKRSITKN
PKIGGLPLIPIQQERNTTLSRRNLESARAELERLRLSAKPDKEPVDPSLKERASIVAHCL
EHKEDKLRNRTRKHRSFNCLEDTGAEVPHGQQKFYKGVKTLRKTEDRKTEDRNSKATLDS
DNKLPSKVIEELNVVLQRTRTLPKEFEDEQMLQKEIK
Download sequence
Identical sequences G3TXD9
ENSLAFP00000003333 ENSLAFP00000020247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]