SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TXQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TXQ6
Domain Number 1 Region: 92-305
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-60
Family DBL homology domain (DH-domain) 0.00000000253
Further Details:      
 
Domain Number 2 Region: 290-446
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000702
Further Details:      
 
Domain Number 3 Region: 7-108
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-20
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TXQ6
Sequence length 551
Comment (tr|G3TXQ6|G3TXQ6_LOXAF) Cdc42 guanine nucleotide exchange factor 9 {ECO:0000313|Ensembl:ENSLAFP00000020364} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=ARHGEF9 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
LITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR
LWVNQEDGVEEVPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLK
DICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPC
FLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPV
QKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQAS
VLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYK
GRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAFREE
RKMVQEDEKIGFEISENRKQAAMTVRKVSKQKGKAAFTSQPHSLSLQCCSNGHTIPKSVK
ERNFPLDDLQFSVNSARSVPPSYPPPQDPLNQGQYLVPDGIVQSQVFEFAEPKRSQSPFW
QNFSRLTPFKK
Download sequence
Identical sequences G3TXQ6
ENSLAFP00000020364 ENSLAFP00000019372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]