SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TXX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TXX1
Domain Number 1 Region: 351-573
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 577-710
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-27
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 3 Region: 110-198
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000248
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TXX1
Sequence length 1016
Comment (tr|G3TXX1|G3TXX1_LOXAF) Pleckstrin homology and RhoGEF domain containing G5 {ECO:0000313|Ensembl:ENSLAFP00000020429} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=PLEKHG5 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
RTEGRESRVCHHADCQRLHHQGPLNLCEACDSKFHSAMHYDGHVRFDLPPQGSVLARNVS
TRSCPPCTSLAVDLEEEEEGSMDGKGDRKSTGLRLSKKKARRRHTDDPSKECFTLKFDLN
VDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSLTFEAYRFGGHYLR
VKAKPGDEGKVEQGVKDSKSLSLPILRPAGARAPSLERGDPQSRRESLDILAPGRRRKNM
SEFLGEVSIPGQEPPTPSSCSLPSGSSGGPSSTGGDSWKNRAASRFSGFFSSGPSTSAFG
READKMEQLEGKLHAYSLFGLPRLPRRLRFDHDSYGACVQLEDSWRELIDGHEKLTRRQC
HQQEAVWELLHTEASYIKKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNITEIARLHR
GLWRSVMAPVLEKARRTRALLQPGDFFKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRD
NDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDEPRAKEAVVTMI
GSMERFIHHVNACMRQRQERQRLAAVVSRVDAYEVVEGSNDEVDKLLKEFLQLDLTAPIP
GASPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERTKVIRPPLLVDK
IVCRELRDPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDAIYNAQNQLQQLRAQEHP
GSQQPLQSRESSTSAASSPTILRKSSNSINSQHCASDGSTETLAMVVVEPGETLSSPEFE
GGPFSSQSDETSLSTTASSITPISELLPLGPVDGRSCSMDSAYGTLSPTSLQDFVAPAPV
VEPVPQLPELPQAPSPPPSPRLRRRTPVQLLPRLPHLLKSKSEASLLQLLSGTATCGVPL
APSRSLSELCLATEAPRSRTQGSPQEAGPRWDCQGAPSPGSGPELSEPEDGTSGLAGEPT
GPTGRRHRELPSGVSPRVQPEPPPGISAQHRKLTLAQLYRIRTTLLLNSTLTASEV
Download sequence
Identical sequences G3TXX1
ENSLAFP00000020429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]