SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TZW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TZW2
Domain Number 1 Region: 3115-3427
Classification Level Classification E-value
Superfamily BEACH domain 3.66e-112
Family BEACH domain 0.000000114
Further Details:      
 
Domain Number 2 Region: 3545-3792
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-33
Family WD40-repeat 0.01
Further Details:      
 
Domain Number 3 Region: 3017-3120
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-21
Family PreBEACH PH-like domain 0.012
Further Details:      
 
Weak hits

Sequence:  G3TZW2
Domain Number - Region: 1542-1697
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000791
Family Clostridium neurotoxins, the second last domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3TZW2
Sequence length 3806
Comment (tr|G3TZW2|G3TZW2_LOXAF) Lysosomal trafficking regulator {ECO:0000313|Ensembl:ENSLAFP00000021120} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LYST OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MSTNSNLLAREFLTDVNRLCNAVVQRVEAREEEEEETHMATLGQYLVHGRGFLLLTKLNS
IIDQALTCREELLTLLLSLLPLVWKIPVQEEKATDFNLPFSADIILTKEKISSSQRPPQD
KLYLEGSTPCGQVSAKVNIFPKSRRQRKTTHRYSIRDARKTQLSTSDSEANSDEKSITMN
KHRRPHLLLHFVTQPPKEDHLTAEVDHSATKEGQTPPDTMALENSREIIPRQESNTDILT
EPAALSVISNMNNSPFDLCRVLLSLLEKVCKFDITLNHSSALAASVVPTLTEFLAGFGDC
CNLSNNLENQVVSAGWTEEPVALIQRMLFRTVLHLMSVDISTAETMPESLRKNLTELLRA
ASKIRACLEKQPDPFAPRQKKTLQEVREDFVFSKYRHRALLLPELLEGVLQILICCLQSA
ASDPFYFSQAMDLLQEFIQHHGFNLFETAVLQMEWLVLRERVPAEASEHLKALINGVMKI
ISTVKKVKSEQLHHSVCTRKRHRRCEYSHFMHHHRDLSGLPVSAFKNQVSKNPFEETADG
GVYYPERCCCIAVCAHQCLHLLRQVSLSSTCVQILSGVHSVGICCCMDPKSVIVPLLHAF
KLPALKNFQQHILNILNKLILDQLGGAEISQKIKKAACNICTVYSDQLAKLEETLQGNTC
DAESSSSLSSPSYRFQGILPSSGSEDLLWKWNALETYQNFVFEDDKLHSIQIANHICSLI
QKGNVVVQWKLYNYIFNLMLQRAVELARHCQHLSITTARTHVCSHHSQCLPQEVLEIYLK
TLPTLLKSRAIRNLFLSCNGVNQIIELNYLDGIRSHSLKAFETLIISLGEQQKDASVPGT
DGLDSEQKESSSVIVGTSFHNQQVYSDSPQSLSKFYTDLKDAYPKKWKTVNQDVHINTIN
LFLCVAFLCVSKEAESDRDSANDSEDTSGYDSTASEPLSHMLPSLSLESLALPSPEHMHQ
AADIWSMCRWIYMLSSVFQKQFYRLGGFQVCHKLIFMVIHKLFRSHEEGQEKKQEGINVN
ESQALSRTSQSEIAIEEDLLSLTVKIDPTPSELSSLRKSADGLGKLESQQIFPTNVEKIS
AAEVASKDAKVFTSQENETSLQSIRLLEALLAICLHSARTTQQKMELGLPNQNLSVENIL
LEMRDHLFQSKVTETELAKPLFDALLRVALGNHSADFEPSDATTEKSHQSEEELSSQTGD
FSEETEDSQGCSFKLFVEEEGYEADSESNPEDGESWDDGVDLKPEAEGFSASSCPSYFLE
NLTQGEIIYPEICMLELSLLSSSKAKLDVLTHVFESFLKIIRQKEKNIFLLMQQQGTVKN
LLGGFLSILIQADADFQACQRVLVDLLVSLMSSRTCSEDLTLLLRIFLEKSPCTEILLLG
ILKIVETDISMCPSQYLTFPLLHTPNVSNGVSSQKGLGILNSKAVALLRRARVSRSKKET
DSENFPHQLLSSWHIAPIHLPLLGQNCWPHLAEGFSVSLWFNVECSHETESLIEKGKKMK
KRNKSAIVWDSSFGGTESNRPEDAQYINPGEKLIEEGSIHVISLGSKALMIQVWANPHNG
TFIFRVCMDSNDDTKAVLLAQVESQENVFLPSKWQHLVLTYVQQPQGKKNIHGKLSMWVS
GQRKTDVTLHYMLPRKTSLSSDSNKTFCMIGHCLSSQEECLQLAGKWDLGNVLLFNGAKI
GSQEAFYLYACGPNHTSIMPCKYGKPVNDYSKYISKEILRSEQIRELFMTKKDVDVGLLI
ESLSIVYTPYCPAQYTIYEPVIRLKGQMKTQLSQRPFSSKEVQSISLEPHHLKNLRPTEC
KTIQGVLHEIGGTGIFVFLFARVVELSSCEETQALALRVILALTKYNQQRIHELENCNGL
SMIHQVLIKQKCIVGFHILKTLLEGCCGENIIHVTENGEFQLDVESNAIIQDVKLLEELL
FDWKIWNKAEQGVWETLLAALEVLIRADHHQQMFNMKQLLKARVVHHFLLTCQVLQEHKE
GQLTSMPREVCRSFVKIIAEVLGSPPDLELLTIIFNFLLAVHPPTNTYVCHNPTNFYFSL
HIDGKIFQEKVQSIIYLRHSSSGGKSATSPEFVCLGPFSVTTTTISMTSRNNSSSIIPQR
MTAHILRSRSLPAFPTSSPLKQPQKLTTSLDCSIDKLQNIADNYVATPPEKWNPLGSSEM
LKKGKEDAFISSCESAKTVCEMEAVLSAQTSVNGVPKGKLVFPVVKVDHKEMGSERRSDD
DSPGDESCPRRPDFLKGLASFQQSHSTIASLGLAFPSQNGSAAVGRWPSLVDRSTDDWEN
FAVSLGYEQNYNRTANAHSVTEDCLVPICCGLYNLLSGVLLILPDVMLEDVMDKLIQADI
LLVLVNHPSPAIQQGVIKLLDAYFNRASKEQKDKFLKNRGFSLLANQLYLHRGTQELLEC
FIEMFFGRRIGLDEEFDLEDVKNMGLFQKWSVIPILGLIETSLYDNILLHNALLLLLQIL
NSCSKVADLLLDNGLLYVLCNTVAALNGLEKSIPLNEYKLLACDIQQLFIAVTIHACSSS
GSQYFRVIEDLIVLLGYLQNSKNKRTQTMAVALQFRVLQAAVEFIRTTANQDSENLTNSF
QLPSAPHHTMFQKQKTIAGPRKFSLAQTESLLIKMRSVASDELHMMMQRRMSQENPVQAT
ETELAQRLQRLLVLAVNRIIYQEFNPDVVDILSTPENITQSKNSVPQTEISEETIHHAQP
SVFNPFQKEMFTYLVEGFKVSIGSNKASGSKQQWTRILWSCKDTFRMQLGRLLVHILSPS
HSSQERKQIFEIVHEPNHQEILRDCLSPSLQHGAKLVLYLSELMHNHQDELTKEELDTAE
LLMNALKLCGHKCSPPSAATKSDLIKMIKEEQKKYETEEGVNKATWQKTVNNNQQSLFQR
LDSKSKDISKIAADITQAVSLSQGIERKKVIQHIRGMYKIDLSASRHWQELIQQLTHDRA
VWYDPIYYPASWQLDPTEGPNRERRRLQRCYLTIPNKYLLRDRQKSEDLVKPPLSYLFED
KTHSSFSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDAVESSS
LQGELEPASFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHSIL
TNNLPNLLEYGNITALTNLWYAGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVS
ETLDLSDPSIYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGS
HYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIP
EFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNIC
QWIDLVFGYKQKGKASVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLF
HTAHSSRPGSKLNIEGELPAAVGLLVQLAFRETREQVKEVTSPSPLSWIKALKWGEYVGS
PSAPVPVVCFSQPHGERFGSLQALPTRAICGLSRNFCLLMTYSKEQGVRSMNSTDIQWSA
ILSWGYADNILRLKSKQSEPPINFIQSSQQYQVTSCAWVPDSCQLFTGSRCGVITAYTNR
LTSSTPSEIEMESQIHLYGHTEEITSLFVCKPYSIMISVSRDGTCIIWDLNRLCYVQSLA
GHKSPVTAVSASETTGDIATVCDSAGGGSDLRLWTVNGDLVGHVHCREIICSVAFSNQPE
GVSINVIAGGLENGIVRLWSTWDLKPVREITFPKSHKPIVSLTFSCDGHHLYTANSEGTV
IAWCRKDQQRLKQPMFYSFLSSYAAG
Download sequence
Identical sequences G3TZW2
ENSLAFP00000021120 ENSLAFP00000012635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]