SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3U095 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3U095
Domain Number 1 Region: 82-223
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-32
Family Pleckstrin-homology domain (PH domain) 0.00000142
Further Details:      
 
Domain Number 2 Region: 237-357
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.76e-28
Family PLC-like (P variant) 0.0061
Further Details:      
 
Domain Number 3 Region: 4-82
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-26
Family DBL homology domain (DH-domain) 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3U095
Sequence length 367
Comment (tr|G3U095|G3U095_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000021253} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
KLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHVDHSSLKLALERAEELCS
QVNEGVREKENSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKLYKTKSNKEL
HGFLFNDFLLLTYMVKQFAVSSGSEKLFSSKSNAQFKMYKTPIFLNEVLVKLPTDPSSDE
PVFHISHIDRVYTLRTDNINERTAWVQKIKAASEQYIDTEKKKREKAYQARSQKTSGIGR
LMVHVIEATELKACKPNGKSNPYCEISMGPQSYTTRTLQDTLNPKWNFNCQFFIKDLYQD
VLCLTMFDRDQFSPDDFLGRTEVPVAKIRTEQDSKGPTTRRLLLHEVPTGEVWVRFDLQL
FEQKNLL
Download sequence
Identical sequences G3U095
ENSLAFP00000021253 ENSLAFP00000021253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]