SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3U0X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3U0X9
Domain Number 1 Region: 10-172
Classification Level Classification E-value
Superfamily RUN domain-like 2.62e-40
Family RUN domain 0.00081
Further Details:      
 
Domain Number 2 Region: 1345-1459
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.48e-29
Family Supernatant protein factor (SPF), C-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1146-1210
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.15e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0012
Further Details:      
 
Weak hits

Sequence:  G3U0X9
Domain Number - Region: 849-1084
Classification Level Classification E-value
Superfamily Tropomyosin 0.00144
Family Tropomyosin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3U0X9
Sequence length 1461
Comment (tr|G3U0X9|G3U0X9_LOXAF) FYVE and coiled-coil domain containing 1 {ECO:0000313|Ensembl:ENSLAFP00000021487} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=FYCO1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MASTSAESQLQRIIHDMQDAVTELSKEFKEAEEPITDDSTSLHKFSYKLEYLLQFDQKEK
ATLLGHRKDYWDYFCDCLAKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLKPKLSSDIVGHLYELTEVQFDLASRGYDLDAAWPTFAR
LVTIFSVEKSIYQPPGFNRGRLSLVNFVRNTQEMASSLDMNSPLNNEALEGFDEMRLELD
QLEVREKQLQERMQKLDKENQELRAAVTSQGEQLQMEREKRSTATEENVRLMSLVAELQK
QWEVTQATESTVKELQKCLQALELGAAEKEDYQSALQRLESLLQPLPQELKATRDSLGGK
NQQLPSVPAWVARAEQKVGMTLGTKGQQDPVPSDSALVIQELGAKLRALEEESIKVQELN
RQQNAQLEQLTKELQLKEEAQASLEHVVMEMTPLREELAKKEQEAAQLRCQLQESLAHVS
SLEEELVEVRHKEQRWREEEELLEQEARSLTRQLQVLETQLSQVSQHVSDLEEQKKQLIQ
DKDHLSQKVGTLEQLAGQPGPEPQTCEKPEEEQRGPQEGHLSDTKGGQEEKLQQANRELE
KELQNVLECNQLLEGKLQVLQADYEALQQREAAIQGSLASLESEQASIRLMGDQMEALLA
VRKAKEIMRARVAEKDAALKSKEDECQQLREEAEQCRQLAEARDGELRALKSQCHQQTQQ
IQTPTTEKGQQGLGPPQDDVSHELEAQLALSQAQLEVHQGEVQCLKTEVVDLQAKLLAAL
DDREKVQSQLGVAEEVLREHKALVQQLKEQNEALNRTHVQELLQRSEQEGALQEERTGEA
QQRAKELWALQEELTRLKQNSAEAQLEHAELQEQLHRANTDTAELGIRVCTLTAEKEKME
GALACATQELQDAKEAASREREGLEHQVAGLQQDKESLQEKLKAAEEAAGSLAGLQAQLA
QAEQWAQGLQETAHQELNTLKFQLSTEVMDYQNRLKAASEECRSLRGQLEEQGQKLQAAE
EAVGKLKATQADMREKLRSTSNHLSECQAAVLQKDEEGAALRANLERTQKDLEKATTKFQ
EYYNRLCEEVTDREKNDQKMLADLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQK
LSAEERWLGDTEASHCLDCKREFSWMVRRHHCRICGRIFCYYCCNNYVLTKHSGKKERCC
RACFRKFNEGPGSPDSTSSGNSQGEPSSTLPPAQAGHQATRGQDSLCDLHANTDGRPPDD
AVFDIITDEELCQIQESGSSLPETPTETDSLDPNMAEQDNTSTSLTPEDTVDMPVGQDTE
ICLLKSGELMIKVPLTVEEIVSFGEGNRELFVRSSTYSLIPISVAEAGLTISWVFSSDPK
SISFSVVFREAEDTPLDQCKVLIPMTRCNSHKENIQGQLKVRTPGIYMLIFDNTFSRFVS
KKVFYHLTVDRPVIYDGSDFL
Download sequence
Identical sequences G3U0X9
ENSLAFP00000021487 ENSLAFP00000021487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]