SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3U263 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3U263
Domain Number 1 Region: 127-268
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-16
Family Second domain of FERM 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3U263
Sequence length 454
Comment (tr|G3U263|G3U263_LOXAF) FERM domain containing 8 {ECO:0000313|Ensembl:ENSLAFP00000021921} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=FRMD8 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MDATEGSAGPPGPAELSHRSSVSSVGARAADVLVYLADDTVLPLAVDNLPALSAHELHRT
VREVLQLPDIAVDAFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTDAPDEDLAMDE
PSLQFRRNVFFPKRRELQIRDEEVLRLLYEEAKGNVLTARYPCDVEDCEALGALVCRVQL
GPYQPGQSAACTLREKLDSFLPAHLCKRGQGLFAALRGRGTKAGPGEQGLLNAYREVKEV
VGSDGEGENPLSIHYRAYLFKCHELPFYGCAFFHGEIDKPAQSFLHRGGRKPVTVAISLE
GVHVIDCREKHVLLGLRFQELSWDHTSPEEEEPVLWLEFDGESEGMPVNKLLKIYSKQAE
LMSSLIEYCIELNQAVEPAAPQDSGSGPTSAPGASPPPTQRPKLLRQGSVVCSRIQHLST
IDYVDDGKEIKRVKPKRTTSFFSRQLSTSQGSYT
Download sequence
Identical sequences G3U263
ENSLAFP00000021921 ENSLAFP00000021921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]