SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3U4W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3U4W8
Domain Number 1 Region: 114-246
Classification Level Classification E-value
Superfamily C-type lectin-like 8.4e-35
Family C-type lectin domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3U4W8
Sequence length 247
Comment (tr|G3U4W8|G3U4W8_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000022876} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MNNQTVTYSELNLAKNPKRQQIKPTDSDRSISITEQEITYVELNFHGASQDLQKNDKNFH
CKVYLPSPPGKLVAGILGITCIALMASIIIIKIKVITPLNNASSMGTKSGKFILSFSKFC
NSYSFSASHCGHCPEDWLSYSNNCYYISSDKKNWTESQMACASKKSDLTYIDNEEEMKFI
AFLSSLSWIGLSRKNRDYSWLWINGSPLYKELIDTSNNTYNCAMLFSSNLLSDSCGSSKT
YICKHKI
Download sequence
Identical sequences G3U4W8
ENSLAFP00000022876 ENSLAFP00000022876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]