SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3U7G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3U7G3
Domain Number - Region: 601-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3U7G3
Sequence length 889
Comment (tr|G3U7G3|G3U7G3_LOXAF) Transmembrane protein 8B {ECO:0000313|Ensembl:ENSLAFP00000023771} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=TMEM8B OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
SQPRPPLESLTLAWPPSPPLPVFHTFSQIPVQPLSQAHSQCLPKPLAQPLPLLQSSSQPR
LPCHPLSLFKPQCPAQPNPLFQPLPSSPCIPKSLPLPVPLSHTLPLSQPRLRTGLQLPPA
LLLLLLFSVLGPGAGGLFLTDYSTCSPRKLSPFRSFASTELFHFHVPEDTFLAVWNLIIF
KEQGGTFGDHCPDQSVTVYFRSGAPPVINPLHTHFPGDTAVPGVFSLNLSWTLPNRTSGI
FNVSSPLPGDWFLAAHLPQAHGHISVKGLQDECQYLLQPQLIVRRLLDVAVLVPGRPSEQ
TLSSHNRSALYKVFVPSFTYRVSAQLVCVGGHGTSTCPLTLRLRPKAPPLHNSSSVTCGG
TSACQLELALPPWGHWVYVRVETPPRGPGRTVRFQLCVRLQECPQPSLSRALVPGAAMNM
PQSLGNQALPPEPPSLGALADGPGATSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVSL
PPERPAVFSLRLLPVLDSGGVLTLELQLNASSLHQENVTVFGCLTHEVPLSLGDAAVTCS
KEALAGFLLSVSAISRVARLRIPFPQTGTWFLTLRSLCGVGPQFVRCRNATAEVRLRTFL
SPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSN
LMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFLGSL
MSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATAWTV
RSVRRRHCYPPTWRRWLFYLCPGSLIAGSAILLYAFVETRDNYFYIHSIWHMLIAGSVGF
LLPPRAKTDHRVPSGSRARGCGYQLCINEQEELGLVGPGGAAVSSICAS
Download sequence
Identical sequences G3U7G3
ENSLAFP00000023771 ENSLAFP00000006466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]