SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3U839 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3U839
Domain Number 1 Region: 414-608
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-65
Family Nuclear receptor ligand-binding domain 0.0000242
Further Details:      
 
Domain Number 2 Region: 127-216
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-29
Family Nuclear receptor 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3U839
Sequence length 611
Comment (tr|G3U839|G3U839_LOXAF) Nuclear receptor subfamily 1 group D member 1 {ECO:0000313|Ensembl:ENSLAFP00000023997} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NR1D1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGNIPPSLSDDSPSSSSSSSCSSSFYNGSPPGGLQVAMEDSSRVSPSKSTSNI
TKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIVRINR
NRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSPT
QHPTPGPMGPSPPPAPTPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTY
AHDKLGTTPGNFNANHASGSPPATTPHRWESQGCPPVPNDNNAVAAQRHNEALNSLRQAP
SSYPPSWASGPAHHSCHQPNSNGHRLCPTHMYSTSEGEASANSPRQGNSKNVLLACPMNM
YPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFCDLSQHDQVTLLKAGTFEVLMV
RFASLFNVKDQTVMFLSRTTYSLQELSAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTA
VVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPLRTLNNMHS
EKLLSFRVDAQ
Download sequence
Identical sequences G3U839
ENSLAFP00000023997 ENSLAFP00000023997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]