SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3U9F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3U9F5
Domain Number 1 Region: 98-344
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-63
Family Nuclear receptor ligand-binding domain 0.0000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3U9F5
Sequence length 346
Comment (tr|G3U9F5|G3U9F5_LOXAF) Nuclear receptor subfamily 3 group C member 2 {ECO:0000313|Ensembl:ENSLAFP00000024463} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NR3C2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MNHCLQKKVLKSQCSCWSKKTCLEGKYALSNLRARKSKKLGKLKGIHEEQPQQQQALPPP
PPPQSPEEGTTYIAPMKEPSVNTALVPQLSTLSRALTPTPAMILENIEPEIVYAGYDSSK
PDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRS
YKHTNSQYLYFAPDLVFNEEKMHQSAMYELCQGMHQVSLQFVRLQLTFEEYTIMKVLLLL
STIPKDGLKSQAAFEEMRANYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDL
LEFCFYTFRESQALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences G3U9F5
ENSLAFP00000024463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]