SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3U9P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3U9P5
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily RUN domain-like 1.28e-36
Family RUN domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3U9P5
Sequence length 395
Comment (tr|G3U9P5|G3U9P5_LOXAF) RUN domain containing 3A {ECO:0000313|Ensembl:ENSLAFP00000024553} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=RUNDC3A OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
XSSEEFVNFAAILEQILSHRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSI
ENMENISTARAKGRAWIRVALMEKRMSEYITTALRDTRTTRRFYDSGAIMLREEATVLTG
MLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQRSYDYLTDEEERHSAESSTSEDN
SPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQL
QLEEAAAQNQREKRELEGVILELQEQLTGLIPGDHAPLTQGSKELTTPLVNQWPSLGTLS
GAEGAHNPKLYRRHSFMSTEPLSAEASLSSDSQRLGDCKRDEEPWGPIGKDPTPSMLGLC
GSLASIPSCKSLASFKSNECLVSDSPEGSPALSPS
Download sequence
Identical sequences G3U9P5
ENSLAFP00000024553 ENSLAFP00000024553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]