SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UCT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UCT1
Domain Number 1 Region: 380-553
Classification Level Classification E-value
Superfamily Fibronectin type III 3.57e-31
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 2 Region: 115-291
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-24
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 249-381
Classification Level Classification E-value
Superfamily Fibronectin type III 3.17e-23
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 4 Region: 2-131
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000102
Family Laminin G-like module 0.0072
Further Details:      
 
Weak hits

Sequence:  G3UCT1
Domain Number - Region: 561-599
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000328
Family Fibronectin type III 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UCT1
Sequence length 611
Comment (tr|G3UCT1|G3UCT1_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000025639} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN= OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
IQVELRSGILSFLLNTSFTLTQVDLQLGLSYCDGKWKKVIMKKEGSVILASMNELTERVL
QSRAQPLMVNSPVYVGGIPQELQDTYRYLSYEQGFGGCMKDVKFTRGAVVSLASVSSSAV
RVNLDGCLSTDSAVNCRGDDSILVYRGMEQSVYESGLQPFTEYLYRVKASHEGGSVYSDW
SRGRTTGAAPQNVPTPSRGHSINGYSIEVTWDKPVVVRGIIEKYILKAYSEDDRKTSLVP
SASTELLNTSTLTGILTGLLPFKNYMVTLSACTLAGCTESSHALNISTPQEAAPQEVQPP
VAKSFPNSLLVSWKPPKQANGIITQYSLYMDGMVIYSGSGENYAVTVLRIFTPHQFLLSA
CTHVGCANSSWVTLYTAQLPPDHVESPTLTVLDSTTIYIQWQQPRKINGILERYILYISN
CTHDFTVWNVIYNSTELFQDHMLPHLFPGNKYLIKLEACTGGGCTVSDVSEAYTDESTPE
GVPAPRARSYSPDSFNISWTEPEYPNGVITSYGLYLDGVLIHNSSELRCHAHGFAPWSLH
SFRLQACTAKGCAMGPLVENRTLEASPEGVVNVFVKAGGPREAHVKWEEPFSPNGRLTYS
VLFTGIFYADQ
Download sequence
Identical sequences G3UCT1
ENSLAFP00000025639 ENSLAFP00000025639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]