SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UE32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UE32
Domain Number 1 Region: 24-159
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-34
Family Pleckstrin-homology domain (PH domain) 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UE32
Sequence length 1170
Comment (tr|G3UE32|G3UE32_LOXAF) Pleckstrin homology domain containing A7 {ECO:0000313|Ensembl:ENSLAFP00000026090} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=PLEKHA7 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MSKQERNQRPSSMVSETSTAGTTSTLEARPGPKIIKSINKVHSFGKRDQAIRRNPNVPVV
VRGWLHKQDSSGMRLWKRRWFVLADYCLFYYKVKDSREEAVLGSIPLPSYVVSPVTPEDR
ISRKYSFKAEHSGMRTYYFSADTLEDMNAWVRAMNQAAQVLSRSSLKRSPSPSRDADVEK
VERQAVPQANHTDACRECGRVGPRHARDCPHRGHDDSYGFERQEQEEEGYRSQRDPLEGK
RDRSKARSPYVSAEEDALFVDLPGGSRGQQAQPQRAEKNGMLPASYGPGEQNETGGYQRA
FPPRTNSEKHSQKKSSLAQVEHWAKASKGDGRSLPSEQTLPRQGPSQPLSFPENYQTVPK
NTRHPSGSSSPPPRNLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQRQQFRHG
SPTAPICAGSPEFTDQGRSRSMLEVPRSISVPPSPSDIPPPGPPRAFPPRRPHTPAERVT
VKPPDQICFPAAWKAGKDVCVRSAQLLVDRRSMPSMGYMTHTVSAPSLHGKSADDTYLQL
KKDLEYLDLKIKNNEPLINVLYKVLKKSARGCRPRRSLVAVVHVFCDGVYTLKIAESDID
VKLSVFCEQDRILQDSEDKIRALKENKDQLESVLEVLHRQMEQYRDQPQHLEKIAYQQRL
LQEDLVHIRAELSRESTEMENAWNEYLKLESDVEQLRQTLQEQHRRAFFFQVEKSQIQKD
LWRIEDVIAGLSANKNSWGNRTSQRPKGVLSPEQLMSSIYPAICLLSTVPVLRIATPNSP
PSNSLSSDTGSGSFSEQEDEAPPRPPLPELYSPEDQPPAVPPLPREATIIRHTSVRGLKR
QSDERKRDRELGQCVNGDSKPLQAGLLGGCHQLGYLVPSRGQEAEGHKEVFMAPVGYVTS
SPPHCLTGLWPELAPGRLGKQPSCSICNSPSHPLQRPKSALERLYSGDHQRGKMSAEEQL
ERMKRHQKALVRERKRTLSQAQTPKGQEVTALNPLVCCQWKREQDFDLQLLERAMQGERK
DKEENGWLKLQAMPVTELDLEPQDYDLDISRELSKPEKVAIPERYVELDPEEPPSLEELQ
ARYRKAEKIRSILTRSSVSNLQSAASQDQNSVADLDSQLQEQERIINISYALASEASQRS
KQVAAQQLVLLPPKAPLSSRPTPPYPPLSN
Download sequence
Identical sequences G3UE32
ENSLAFP00000026090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]