SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UET9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UET9
Domain Number 1 Region: 1331-1643
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.01e-112
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000118
Further Details:      
 
Domain Number 2 Region: 1607-1895
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.27e-95
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000701
Further Details:      
 
Domain Number 3 Region: 318-512
Classification Level Classification E-value
Superfamily Fibronectin type III 1.79e-44
Family Fibronectin type III 0.00043
Further Details:      
 
Domain Number 4 Region: 510-707
Classification Level Classification E-value
Superfamily Fibronectin type III 2.25e-41
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 5 Region: 705-892
Classification Level Classification E-value
Superfamily Fibronectin type III 7.66e-28
Family Fibronectin type III 0.00043
Further Details:      
 
Domain Number 6 Region: 31-125
Classification Level Classification E-value
Superfamily Immunoglobulin 9.04e-18
Family I set domains 0.005
Further Details:      
 
Domain Number 7 Region: 135-227
Classification Level Classification E-value
Superfamily Immunoglobulin 3.49e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 8 Region: 230-324
Classification Level Classification E-value
Superfamily Immunoglobulin 7.3e-16
Family I set domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UET9
Sequence length 1903
Comment (tr|G3UET9|G3UET9_LOXAF) Protein tyrosine phosphatase, receptor type S {ECO:0000313|Ensembl:ENSLAFP00000026347} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=PTPRS OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MAPTRGPGVTSVVGPVGLLVVLLVGGCVAEEPPRFIKEPKDQIGVSGGVVSFVCQAAGDP
KPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHA
KLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSAS
NGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPTS
HEIMPGSNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLELTDVKDSANYTCVA
MSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITITWDSGNPDPVSYYVIEYKSKSQD
GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNV
QARMLSATTMIIQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLE
DETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKSETSIGLSWSPPRQESI
IKYELLFREGDHGREVGRTFDPTTVFIVDNLKPHTEYAFRLAARSPQGLGAFTSVVRQRT
LQSKPSAPPQDVKCVSTRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPEPKEVNG
IPPTATQILLEALEKWTEYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRVEAEALNA
TAIRVLWRSPTPGRQHGQIRGYQVHYKKMEENKTRTPGRTVSDPQLCPQEMIITNLQPET
AYSVTVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGTTEDQV
LGYRLQFGREDLMPLATLEFPPSEDHYTAPGVHKGATYVFRLAARSRGGPGEEAAQERMP
AAPPLSPECSQEARNQSQIGCATFGNLLPVSGLGRGPSVCASLSPRDPGRGPPTVSRHAG
PCLWGYMHADVGTHMTARACAGARVSRGIRECSGLSHPPGGHRPVGVMDIHHIKIQITRR
VATGGGGVETAVSVSKSQCSVNGPLHGVNAAAVVDFKLSSRFFFFSRYTVALHCIYFHRA
DTVPIDNLKSTHNKKHNKASVAPSRLDGFIMVYLPDGQPVPVQNYFIVMVPLRKSRGGQF
LPPLGSPEEMDLEELIQDISRLQRRSLRHSRQLEVPRPYIAARFSVLPHTFSPGDQKQYG
GFDNRVLEPGHRYVLFVLAVLQKSEPTFAASPFSDPFQLDNPDPQPIVDGEEGLIWVIGP
VLAVVFIICIVIAILLYKNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTP
GMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANV
IAYDHSRVILQPIEGIVGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSA
TIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKR
EVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAM
LERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYI
QKLAQVEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQ
PIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREM
GREKCHQYWPAERSARYQEWGRVEGTATQPWPALVMQTGLCPFQDGQSRTVRQFQFTDWP
EQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGV
VDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHYAT
Download sequence
Identical sequences G3UET9
ENSLAFP00000001758 ENSLAFP00000026347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]