SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UGI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UGI0
Domain Number 1 Region: 52-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-43
Family SPRY domain 0.0018
Further Details:      
 
Weak hits

Sequence:  G3UGI0
Domain Number - Region: 233-269
Classification Level Classification E-value
Superfamily SOCS box-like 0.00131
Family SOCS box-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UGI0
Sequence length 302
Comment (tr|G3UGI0|G3UGI0_LOXAF) SplA/ryanodine receptor domain and SOCS box containing 3 {ECO:0000313|Ensembl:ENSLAFP00000026938} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SPSB3 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
QHSDSDSDPEFLSLPPSIPSAVPVTGESFCDCDSQSEASFCGGRHSTHSGKDCRCGEEDE
HFDWVWDDLNKSSATLMSCDNRKVSFHVEYSCGAAIRGTKELTEEQDFWEIEMISPVYGT
DMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKMSFSSRFGQGSIIGV
HLDTWHGKLTFFKNRKCIGVAATRLQNKKFYPMVCSTAAKSSMKVIRSCASSTSLQYLCC
YRLRQLRPNSGDTLEGLPLPPGLKQVLHNKLGWVLSMSCSLCWPPAPSPETRPCQRKHCR
RT
Download sequence
Identical sequences G3UGI0
ENSLAFP00000026938 ENSLAFP00000026938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]